Protein Info for AZOBR_RS08665 in Azospirillum brasilense Sp245

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 155 to 253 (99 residues), 65.2 bits, see alignment E=3.1e-22 PF00528: BPD_transp_1" amino acids 175 to 362 (188 residues), 79.8 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 80% identity to azl:AZL_012920)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALT6 at UniProt or InterPro

Protein Sequence (367 amino acids)

>AZOBR_RS08665 amino acid ABC transporter permease (Azospirillum brasilense Sp245)
MTDNVHTGSIPDERPPANTVGPVAWLRNNLFNTWYNALLTILIAWLLFKAIPPLLDWLIF
SANSFGTPPQVCRQEGGACWTFVSEKLRFVMFGTFPYDEQWRPLITIVIIIALVLASCDR
RFWKPWLALVWIAGLTAVGVLMWGGVLGLTYVENTLWGGLPLTLMLSVVGLSVAFPASVL
LALGRRSQLPAIRVISVTYIELIRGVPLISLLFMASVMFPLFLPTGVNFDKLLRAQIAFI
MFAAAYMAEAIRGGLQAIPKGQYEAADALGLNYWQAMGKIILPQALAISIPPLVNTFISF
FKDTSLVIIIGLYDLLGTAKAALSDPAWRGFYREAYLFIGVIYWVFCYSMSKYSQKLERD
LRRGHRR