Protein Info for AZOBR_RS08535 in Azospirillum brasilense Sp245

Annotation: xanthine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 87 to 109 (23 residues), see Phobius details PF13478: XdhC_C" amino acids 87 to 228 (142 residues), 152.9 bits, see alignment E=3.1e-49

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 72% identity to azl:AZL_c02310)

Predicted SEED Role

"Carbon monoxide dehydrogenase F protein" in subsystem CO Dehydrogenase or Carbon monoxide dehydrogenase maturation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALQ8 at UniProt or InterPro

Protein Sequence (238 amino acids)

>AZOBR_RS08535 xanthine dehydrogenase (Azospirillum brasilense Sp245)
MKRDITERLLAARKAGRPVALVTDLGTGLQTLVYEDAIHGGFGLEDDLLEEVRERLRQDR
SGLVSDLEDEEDGVQLFVQTHNPPLRLLVVGAVHIAQALAPLAALTGYAVTVIDPRGSFA
TESRFPGVALHDSWPDEALSALTIDNRTAVVTLTHDPKLDDPALLVALRSPAFYVGSLGS
KRTHAKRLERLKEQGVTDAELARIHAPVGLDIGAVTPAEIALSVMAQITAVRRKAGAA