Protein Info for AZOBR_RS08260 in Azospirillum brasilense Sp245

Updated annotation (from data): L-proline and D-alanine ABC transporter, substrate-binding component
Rationale: Specifically important for utilization of L-proline and D-alanine.
Original annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 25 to 360 (336 residues), 192.9 bits, see alignment E=2e-60 PF13433: Peripla_BP_5" amino acids 34 to 353 (320 residues), 66.7 bits, see alignment E=3e-22 PF01094: ANF_receptor" amino acids 44 to 358 (315 residues), 109.5 bits, see alignment E=2.9e-35

Best Hits

Swiss-Prot: 54% identical to LIVB1_BRUSU: Leu/Ile/Val-binding protein homolog 1 (BR1785) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 89% identity to azl:AZL_e02710)

MetaCyc: 42% identical to branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALJ3 at UniProt or InterPro

Protein Sequence (366 amino acids)

>AZOBR_RS08260 L-proline and D-alanine ABC transporter, substrate-binding component (Azospirillum brasilense Sp245)
MNYKLSLLVAVAATAMTASVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGG
VLGQKLKLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQIS
PASTNPKLTEQNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADET
QKALNAGGQKEKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGL
NAPIVSGDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEGYTLY
TYAALQIWAEAAKQANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNG
QYAQVK