Protein Info for AZOBR_RS08255 in Azospirillum brasilense Sp245

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details PF21741: DUF6867" amino acids 8 to 112 (105 residues), 141.2 bits, see alignment E=7.8e-46

Best Hits

KEGG orthology group: None (inferred from 78% identity to azl:AZL_e02720)

Predicted SEED Role

"FIG00792156: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALJ2 at UniProt or InterPro

Protein Sequence (119 amino acids)

>AZOBR_RS08255 membrane protein (Azospirillum brasilense Sp245)
MDGVLGSSLPVFLGLTVLVFGGCGVLTGQTLAEGWKPLSSAIAYSILLGLGDRFLVWGLF
GGQLLSVYGFVVHTLVIGAITLTTYRISIARRMVSQYPWLYERSGPFGWRERVGGTLAQ