Protein Info for AZOBR_RS08210 in Azospirillum brasilense Sp245

Annotation: lipid A biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07578: LAB_N
  • amino acids 22 to 92 (71 residues), 108.5 bits, E=7.1e-36

Best Hits

KEGG orthology group: None (inferred from 70% identity to azl:AZL_e02820)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

• lipid IV_A biosynthesis (E. coli) (4/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (4/6 steps found)
• lipid IV_A biosynthesis (P. putida) (4/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (4/6 steps found)
• lipid IV_A biosynthesis (generic) (4/6 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (6/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (11/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (3/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (11/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.182

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

See G8ALI1 at UniProt or InterPro

Protein Sequence (111 amino acids)

>AZOBR_RS08210 lipid A biosynthesis (Azospirillum brasilense Sp245)
MLERAIAWYQSQSTADLIWVGVGFFAQALFMMRFVVQWIASERARRSIVPDLFWYFSIGG
GVLLLAYSIQRGDPVFMFGQGLGLIIYFRNLYFVLNNRRNGGADGNAAGTP