Protein Info for AZOBR_RS07840 in Azospirillum brasilense Sp245

Annotation: fructose 1 6-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00330: fructose-1,6-bisphosphatase, class II
  • amino acids 1 to 320 (320 residues), 362.3 bits, E=1.2e-112
• PF03320: FBPase_glpX
  • amino acids 3 to 312 (310 residues), 464.6 bits, E=5.9e-144

Best Hits

Swiss-Prot: 55% identical to GLPX_BACSU: Fructose-1,6-bisphosphatase class 2 (glpX) from Bacillus subtilis (strain 168)

KEGG orthology group: K02446, fructose-1,6-bisphosphatase II [EC: 3.1.3.11] (inferred from 95% identity to azl:AZL_010940)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• gluconeogenesis I (9/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (11/17 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See G8AL92 at UniProt or InterPro

Protein Sequence (321 amino acids)

>AZOBR_RS07840 fructose 1 6-bisphosphatase (Azospirillum brasilense Sp245)
MDRNLALEAVRVTEAAALSASLLMGRGDEKLADQAAVDAMRQALNTLYIDGTVVIGEGER
DEAPMLYIGEKVGAGIGRGPKVDIALDPLEGTTICATGGPNSLAVIAMADEGGFLNAPDV
YMDKIAVGSGLPEGVVDLDETPANNLKALAKAKGTEVQELLVCILNRPRHAELIARVREA
GARIMLINDGDVSGVIATSQAGTGVDMYVGSGGAPEGVLAAAALRCIGGQFQGRLLFRND
DEKARAARWGVKDLNKKYSLTELASGNVMFAATGVTDGAMLRGVRRFPGGATTHSVIMRS
KSGTVRYVEAHHNLQRKPSMA