Protein Info for AZOBR_RS07285 in Azospirillum brasilense Sp245

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 26 to 173 (148 residues), 122.7 bits, E=8.9e-40

Best Hits

Swiss-Prot: 64% identical to LOLD_MAGSA: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 84% identity to azl:AZL_021210)

MetaCyc: 47% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

See G8AKW9 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AZOBR_RS07285 ABC transporter (Azospirillum brasilense Sp245)
MSEPMLELSGIVRTFEQAGTELQVLRGAELTVHAGELVALVGPSGAGKSTLLHIAGLLER
PTAGTVRIAGTDVSALDDGKRTEVRRRSVGFVYQFHHLLPEFSALENIVLPQMINGVAKR
TARERALELLRMVGLEPRAGHRPARLSGGEQQRVAIARALANGPGLLIADEPTGNLDPHT
AEGVFAMLTSIVRQARVGALIATHNLELANRMDRVLEMSDGVLVEHARV