Protein Info for AZOBR_RS06555 in Azospirillum brasilense Sp245

Updated annotation (from data): Branched-chain-amino-acid transaminase (EC 2.6.1.42)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (2.6.1.42) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to LYSN_THET2: 2-aminoadipate transaminase (lysN) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: None (inferred from 76% identity to azl:AZL_021750)

MetaCyc: 43% identical to L-2-aminoadipate aminotransferase monomer (Thermus thermophilus)
2-aminoadipate transaminase. [EC: 2.6.1.39]

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

anteiso-branched-chain fatty acid biosynthesis (31/34 steps found)
even iso-branched-chain fatty acid biosynthesis (31/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (31/34 steps found)
aspartate superpathway (23/25 steps found)
superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
superpathway of aromatic amino acid biosynthesis (17/18 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
superpathway of L-phenylalanine biosynthesis (9/10 steps found)
superpathway of L-tyrosine biosynthesis (9/10 steps found)
L-leucine biosynthesis (6/6 steps found)
L-leucine degradation I (6/6 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
L-valine degradation I (7/8 steps found)
L-valine biosynthesis (4/4 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (6/7 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
L-isoleucine degradation I (5/6 steps found)
TCA cycle VIII (Chlamydia) (5/6 steps found)
L-alanine biosynthesis I (2/2 steps found)
malate/L-aspartate shuttle pathway (2/2 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-aspartate biosynthesis (1/1 steps found)
L-aspartate degradation I (1/1 steps found)
L-isoleucine biosynthesis II (6/8 steps found)
L-phenylalanine degradation III (3/4 steps found)
superpathway of L-alanine biosynthesis (3/4 steps found)
superpathway of L-threonine metabolism (13/18 steps found)
L-isoleucine biosynthesis V (2/3 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-phenylalanine degradation II (anaerobic) (2/3 steps found)
L-valine degradation II (2/3 steps found)
indole-3-acetate biosynthesis VI (bacteria) (2/3 steps found)
L-isoleucine biosynthesis IV (4/6 steps found)
L-glutamate degradation II (1/2 steps found)
L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
trans-4-hydroxy-L-proline degradation I (3/5 steps found)
L-tryptophan degradation VIII (to tryptophol) (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
L-isoleucine biosynthesis III (4/7 steps found)
(R)-cysteate degradation (1/3 steps found)
L-asparagine degradation III (mammalian) (1/3 steps found)
L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
sulfolactate degradation III (1/3 steps found)
superpathway of sulfolactate degradation (3/6 steps found)
L-tyrosine degradation I (2/5 steps found)
superpathway of L-aspartate and L-asparagine biosynthesis (1/4 steps found)
superpathway of chorismate metabolism (40/59 steps found)
L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
L-lysine degradation V (4/9 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-leucine degradation IV (reductive Stickland reaction) (1/5 steps found)
L-lysine degradation XI (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
superpathway of plastoquinol biosynthesis (1/5 steps found)
C4 photosynthetic carbon assimilation cycle, NAD-ME type (5/11 steps found)
coenzyme M biosynthesis II (1/6 steps found)
L-lysine biosynthesis IV (3/9 steps found)
C4 photosynthetic carbon assimilation cycle, PEPCK type (6/14 steps found)
L-lysine biosynthesis V (3/10 steps found)
rosmarinic acid biosynthesis I (2/10 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (1/9 steps found)
indole-3-acetate biosynthesis II (3/12 steps found)
(S)-reticuline biosynthesis I (1/11 steps found)
superpathway of rosmarinic acid biosynthesis (3/14 steps found)
superpathway of L-lysine degradation (15/43 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1, 2.6.1.42

Use Curated BLAST to search for 2.6.1.1 or 2.6.1.39 or 2.6.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AKG1 at UniProt or InterPro

Protein Sequence (404 amino acids)

>AZOBR_RS06555 Branched-chain-amino-acid transaminase (EC 2.6.1.42) (Azospirillum brasilense Sp245)
VTVDWGNVFAGRVAGMGASEIRELLKLLERPEIISFAGGIPDPDFFPTAAIARAYEKIFQ
SNSGAGGALQYTISEGFTPLREWICAYLGRRGIQAGLDEVLVTSGSQQALEFVGKLLIGP
GEKILVTRPTYLGALQAFSPYEPQYLSVPGDAEGPDLAAVEAALEQKPKFFYLVPDFQNP
NGTTISLARREALLDLCAKHGVPIVEDAAYTELRYEGEPIPSMVALDAARNGGKITNVLF
CGSFSKTMVPALRVGWINGPAEVINRLVLMKQAGDLHTSTINQIVLHDVVSQNFDSHIRR
LRAGYKERRDAMLTALSEFAPAGVTWTKPEGGMFVWIELPEGTDGVDLLARAIKDANVAF
VPGSAFHADRSGKNTLRLSFSNNNPERIREGIRRLCGLLQTVAA