Protein Info for AZOBR_RS06550 in Azospirillum brasilense Sp245

Annotation: tRNA delta(2)-isopentenylpyrophosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF01745: IPT" amino acids 6 to 57 (52 residues), 25.7 bits, see alignment 7.3e-10 TIGR00174: tRNA dimethylallyltransferase" amino acids 6 to 283 (278 residues), 222.7 bits, see alignment E=3e-70 PF01715: IPPT" amino acids 39 to 282 (244 residues), 235.3 bits, see alignment E=8.4e-74

Best Hits

Swiss-Prot: 65% identical to MIAA_RHOCS: tRNA dimethylallyltransferase (miaA) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 76% identity to azl:AZL_021760)

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AKG0 at UniProt or InterPro

Protein Sequence (320 amino acids)

>AZOBR_RS06550 tRNA delta(2)-isopentenylpyrophosphate transferase (Azospirillum brasilense Sp245)
VQHRHVVVIGGPTASGKSGMALDIALARNGTVINADSMQLYADLDVLTARPGAEDLALAP
HRLYGVLPAAERGSAARWRDMALAEIAAAHAAGRLPIVVGGTGLYLRTLMEGLSAVPAVP
DEVRKAAHARLQELGGEAFRAELVGRDPASAKLNPGDTTRLTRAWEVLEATGHPLSHWQT
QRAEGAPEGLLFSVLVIDPPRDALYANCDRRFRVMMGQGALEEVRRLDALGLDPDLPAMK
ALGVPELRNHLRGALTLDEAIALAQQSTRRYAKRQVTWFRHQLAARPPASALHGCHTINS
LYTRPLSEAILTYLETTLRR