Protein Info for AZOBR_RS05770 in Azospirillum brasilense Sp245

Annotation: 2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF01565: FAD_binding_4" amino acids 34 to 170 (137 residues), 137.2 bits, see alignment E=3.1e-44 PF02913: FAD-oxidase_C" amino acids 210 to 460 (251 residues), 192.8 bits, see alignment E=8.4e-61

Best Hits

KEGG orthology group: None (inferred from 88% identity to azl:AZL_023910)

Predicted SEED Role

"D-2-hydroxyglutarate dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJX4 at UniProt or InterPro

Protein Sequence (462 amino acids)

>AZOBR_RS05770 2-hydroxyacid dehydrogenase (Azospirillum brasilense Sp245)
IRAIVGPNGLLTAPEDMAPYLSEWRGRFKGNSPAVVRPASTEEVAAVVTICAEAGIPVVP
QGGNTSLVGGSIPYEEGREIVISLSRMNKIRGIDTLNYTMTVEAGVVLKTAQEAAKDKDR
LLPMSLGAEGTCQIGGLISTNAGGINVLRYGNMRDLVLGLEVVLADGRVWNGLRSLRKNN
TGYDLKHLFIGAEGTLGIVTAAVLKLYPRPRQAETAFIAVPSPAAAIELLARLREASGDA
VAAFELMSRRCLEFALKHVAGTIDPLSEPSPWYVLTELTAGTQSDAFRETVEAALGEAFE
AELATDATIAQSETQANQLWFIREAIVEAQKFEGGSIKNDVSVPVSRVAEFIERAEAAVV
AACPGIRPTPFGHVGDGNIHFNLSQPEGADTAAYLARWDEICHVVNEVIFALDGSISAEH
GVGRFKKDEMPVIKSPVEFDLLRAMKAALDPKGLLNPGKMLP