Protein Info for AZOBR_RS03850 in Azospirillum brasilense Sp245

Annotation: putative NAD(+) pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF09296: NUDIX-like" amino acids 76 to 140 (65 residues), 41.9 bits, see alignment E=2.2e-14 PF09297: zf-NADH-PPase" amino acids 142 to 175 (34 residues), 32.9 bits, see alignment 6.4e-12 PF00293: NUDIX" amino acids 179 to 283 (105 residues), 59.7 bits, see alignment E=4.6e-20

Best Hits

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 70% identity to azl:AZL_004310)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIN8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>AZOBR_RS03850 putative NAD(+) pyrophosphatase (Azospirillum brasilense Sp245)
MHDRSSPSDRPNARPNAYAGIPLDRAGVRRKDKDWLKDAWASPTARLLPVAKSRNFVTGD
ADSARAVAVACGGDWGVEPVFLGLLDGVPHFTVDLTGLEAPEDHPALAGLGRFEDLRAVG
PVMEATEAGLCAYARGITWWNARHRFCGVCGSVAAGAEGGHVRVCTNPDCATHHFPRTDP
AVIMLVHDGAGRMVLGRNSRFPPGMHSVLAGFVEPGESLEDSVRREVLEEVGLEVTDIRY
HSSQPWPFPSSLMLGFSARAVTLDIQTDLEELETAHWFDRDFLRTFTPSEEFRLARPDSI
ARRLIDEWIAEGE