Protein Info for AZOBR_RS02840 in Azospirillum brasilense Sp245

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 25 to 640 (616 residues), 795.8 bits, see alignment E=2.3e-243 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 26 to 475 (450 residues), 508.6 bits, see alignment E=1.7e-156 PF00270: DEAD" amino acids 39 to 198 (160 residues), 82.8 bits, see alignment E=6.2e-27 PF00271: Helicase_C" amino acids 238 to 342 (105 residues), 67.2 bits, see alignment E=3.6e-22 PF16124: RecQ_Zn_bind" amino acids 354 to 416 (63 residues), 74.5 bits, see alignment E=2.2e-24 PF09382: RQC" amino acids 418 to 528 (111 residues), 132.9 bits, see alignment E=1.2e-42 PF00570: HRDC" amino acids 572 to 638 (67 residues), 74.7 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 87% identity to azl:AZL_025580)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AHW2 at UniProt or InterPro

Protein Sequence (642 amino acids)

>AZOBR_RS02840 ATP-dependent DNA helicase RecQ (Azospirillum brasilense Sp245)
VDSLFNLKAPPAEPAQDPDGNPALEVLASVFGYSAFRGQQADIIAHVIRGGDALVLMPTG
GGKSLCYQVPALVRDGVTVVVSPLIALMRDQVTALRELGVRAAFLNSSLDAAEAREVERA
MVRGEIDLVYVAPERLVTPRFLDLLDRTKLALFALDEAHCVSQWGHDFRPEYLQLSILHE
RHPTVPRVALTATADAQTRAEIKDKLGLTEARVFLSSFDRPNITYRVVPKKSERQQMLAF
LRENHPEDAGIIYCMSRAKVEDTANWLNQQGREALPYHAGLPSEVREANQDLFIKGEGIV
MVATVAFGMGIDKPNVRFVCHLDPPKSLEAYYQETGRAGRDGLPADAWMSYGMADVVGLR
QMLEQSEAGDSHRRVERSKLEALLGFCETSACRRKVLLNYFGETLEAPCGNCDTCLEPVE
TWDGTVAAQKALSAVYRTGQRYGAGHLIDVLLGNATEKVAQQAHDALKTFGCGKELSKAE
WQSVYRQLVAAGYLTVDLEGYGGFRLTDAGIPVIKGQQTVKLRKDPVVEKRRGVHDALRR
HVSRGGSAPSGGLSGEGVSRAGARGALSPADDALWHALKDCRTELARAQGVPPYVIFHDS
TLLEMVATRPMDRAAFARLPGVGARKLERYADPFLDVIRQKG