Protein Info for AZOBR_RS02685 in Azospirillum brasilense Sp245

Annotation: alkane 1-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03558: luciferase family oxidoreductase, group 1
  • amino acids 11 to 330 (320 residues), 465.3 bits, E=5.4e-144
• PF00296: Bac_luciferase
  • amino acids 21 to 307 (287 residues), 141 bits, E=2.8e-45

Best Hits

Swiss-Prot: 59% identical to YHBW_ECOLI: Luciferase-like monooxygenase (yhbW) from Escherichia coli (strain K12)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 83% identity to met:M446_6282)

Predicted SEED Role

"luciferase family protein"

MetaCyc Pathways

• bacterial bioluminescence (3/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

See G8AH90 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AZOBR_RS02685 alkane 1-monooxygenase (Azospirillum brasilense Sp245)
MPTDDTSRFPISVLDLAPVPEGSTPGDALRNTLDLARHAERLGYRRYWLAEHHNMTGIAS
AATSVVIGHVAAGTATIRVGAGGIMLPNHSPLVIAEQFGTLEALFPGRIDLGLGRAPGTD
QMTLRALRRDPSVAEQFPQDVLELQALLGPVQPGQRVQAVPGAGSNVPLWILGSSLFGAQ
LAAAFGLPYAFASHFAPDALMRALQVYRENFTPSAQLDRPYAMVGVNVVAAETDAEARRL
FTSAQQSFARLIRGTRGQLPPPIDDIESFWSPLEKAQAMNMLSCSFVGSAETVRRGLEAF
LAETGADEIMVASAIHDHAARVRSYEILAEVHGALRAAA