Protein Info for AZOBR_RS02140 in Azospirillum brasilense Sp245

Annotation: O-succinylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 19 to 399 (381 residues), 423 bits, E=1.7e-130
• TIGR01325: O-succinylhomoserine sulfhydrylase
  • amino acids 20 to 399 (380 residues), 537.5 bits, E=6.7e-166
• PF00155: Aminotran_1_2
  • amino acids 57 to 222 (166 residues), 33.5 bits, E=5.7e-12
• PF01041: DegT_DnrJ_EryC1
  • amino acids 70 to 236 (167 residues), 38.1 bits, E=2.2e-13
• PF00266: Aminotran_5
  • amino acids 90 to 217 (128 residues), 28.4 bits, E=1.7e-10

Best Hits

Swiss-Prot: 56% identical to METZ_MYCTU: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 82% identity to azl:AZL_012640)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• L-methionine biosynthesis III (3/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (3/5 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Cysteine metabolism
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Selenoamino acid metabolism
• Sulfur metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See G8AGF1 at UniProt or InterPro

Protein Sequence (402 amino acids)

>AZOBR_RS02140 O-succinylhomoserine sulfhydrylase (Azospirillum brasilense Sp245)
MARTDHRNPNVAGLRPRSRLVHGGVRRSSFDETCEALYQTSGFVYGSAEEAESAFVNDGS
RHVYSRFRNPTTAMFEDRLCEYEGAAWAYATTSGMAAVHGALWSNLRTGDRIVAPRSLFI
SCYWVIKELSARFGVEAVFVDGTDLSQWEEALAKPTKVVFLETPSNPGLEVVDLRAVSAL
AHKAGAKVVVDNAFATPVLQRPFEMGADVVIYSATKHIDGQGRCLGGIILTNDKQYGSDV
IHPYLRHTGPTISPFNAWLLLKGLETLELRVSAQSAAALTVAEFLEGHAKVERVLYPGLA
SHPQHDLVRSQMTGGGTMLSIFLKGGKEEAFRALNDLRMVMISNNLGDSKSLITHPDTTT
HSKLTVEEKAAANIRPNLLRLSVGLEDAQDIVEDLDRALASL