Protein Info for AZOBR_RS01145 in Azospirillum brasilense Sp245
Annotation: Crp/Fnr family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to FIXK_BRADU: Nitrogen fixation regulation protein FixK (fixK) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 90% identity to azl:AZL_003420)Predicted SEED Role
"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8AFB5 at UniProt or InterPro
Protein Sequence (245 amino acids)
>AZOBR_RS01145 Crp/Fnr family transcriptional regulator (Azospirillum brasilense Sp245) MPPFDMGRAREKGAASEMNPCGACPVRSLTVCAALDPEELRRLADILQTSRVEAGQTLFS EGDAADALYNVTAGTVKLYKLLPDGRRQITGFLVTGDFLGLAVNESYAYTAETVTAATLC RFPRKKIDALMDEFPKMQRRLFSMASNELAAAQDQMLLLGRKTAKEKICSFLLMLSQRAA RRGHKENPVYVPMSRADIADYLGLTTETVSRTFTQLKTAGVISLQEGNKVLISDMDAIYD MAEGC