Protein Info for AZOBR_RS00305 in Azospirillum brasilense Sp245

Annotation: porphobilinogen deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00212: hydroxymethylbilane synthase
  • amino acids 5 to 297 (293 residues), 347.8 bits, E=2.1e-108
• PF01379: Porphobil_deam
  • amino acids 5 to 216 (212 residues), 271.2 bits, E=5.5e-85
• PF03900: Porphobil_deamC
  • amino acids 229 to 298 (70 residues), 60.9 bits, E=1.2e-20

Best Hits

Swiss-Prot: 60% identical to HEM3_PARDP: Porphobilinogen deaminase (hemC) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 84% identity to azl:AZL_004040)

MetaCyc: 55% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (27/33 steps found)
• tetrapyrrole biosynthesis II (from glycine) (4/4 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (5/6 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• superpathway of heme b biosynthesis from glutamate (7/10 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (25/36 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

See G8AEB0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>AZOBR_RS00305 porphobilinogen deaminase (Azospirillum brasilense Sp245)
MTQPLRIGTRGSPLALAQAHETRDRLIAAHPHLAAPGAIEIVVFKTTGDRILDRTLAEAG
GKGLFTKELEDALLDGRADLAVHSMKDVPTWMPDGLEISTLLPREDTRDAFFSRGGHTVD
TLPAGSVVGTAGLRRQAQILERRPDLTVVPFRGNVQSRLAKLEAGEVDATLLALAGLRRL
GLTDRITAVLEHEEMLPAVAQGAIGIEIRSADDSTRALLAPLNCAATTARVTAERALLAM
LDGSCRTPIAGLATLDGDRLHLKAKVLSNDGRQVFRAERSGSASDAAAIGADAGAEIKAV
LPPDFFKS