Protein Info for AO356_29830 in Pseudomonas fluorescens FW300-N2C3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1009 TIGR00229: PAS domain S-box protein" amino acids 126 to 249 (124 residues), 68.4 bits, see alignment E=3.2e-23 amino acids 533 to 658 (126 residues), 31.3 bits, see alignment E=9.4e-12 PF00989: PAS" amino acids 128 to 239 (112 residues), 39.6 bits, see alignment E=1.6e-13 PF13426: PAS_9" amino acids 141 to 241 (101 residues), 40.9 bits, see alignment E=7.2e-14 amino acids 562 to 652 (91 residues), 24.4 bits, see alignment E=9.9e-09 PF08447: PAS_3" amino acids 151 to 233 (83 residues), 41.7 bits, see alignment E=3.9e-14 PF08448: PAS_4" amino acids 262 to 368 (107 residues), 24 bits, see alignment E=1.4e-08 amino acids 542 to 652 (111 residues), 38.8 bits, see alignment E=3.4e-13 amino acids 671 to 781 (111 residues), 47.2 bits, see alignment E=8.6e-16 PF07730: HisKA_3" amino acids 808 to 874 (67 residues), 57.5 bits, see alignment 5.7e-19 PF02518: HATPase_c" amino acids 915 to 1004 (90 residues), 47 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a2253)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X336 at UniProt or InterPro

Protein Sequence (1009 amino acids)

>AO356_29830 histidine kinase (Pseudomonas fluorescens FW300-N2C3)
MLKNSDQRMGRMDSAIAVATPFTQDADDVGVVLLDAQGTLLIMDDCASRLLGLSESVAAL
VPSPALFSLKRLTFEKHLTHARLKGNWHFQSASANGDTLKVTLDYRAQQSTFLVKIRHAE
RIHLAEQDYRLAFDSAGTGLALLRMSGEWIAANQMLCQMLGYTEAELRATSFQRLTHPDD
TDISKDELHRLILGHRTSLTLEKRYIRKDGSTLWARLTLGIARNADAEALYFVSQLEDIS
EHLALRQALFNNEQKYLSLAKSSQNIILRYNRLGQQIYANPELERARGFPNTHITERAST
HNPLDEYFRTQVELTLSTGVANTFLLENRGSHSRRSVDFLCNLTPEHDETGELCGVLVTA
QDISALRRQERAENARSAIFQKMVTHDTLREVLPLLGAYLDILTPGLHNAMAFKAVPGDE
SHRAPPTDTSSIATCLAEDLDRHPERFEHHHFIADLKSDAAGLAFSQPALQAGYRGCWVE
PVVNKTGVAMGAILLFVGGDAQLSEQDRKHAQMASHIGAIAWERCSAHSHLAQSERRYRE
VFDHSQDMLCLLAVDADQQLSCLEANPKLCEMLAKSHSDMIGQSLGQCLEKEAASIVEAI
CLHCIAVGAPIELDAHLPCGQRSLVVHFNLVPVADSNGRLHRLVCIARNITDILEAQRNE
LARQQEIGTLVENSPDGIARLSRTAELLFVNPALEAWLDRPQIDLLHKDLLEILPKNLQS
QLFHAAVIEAVEKGQPLEHEYVLTEQHRLQRVYHISLVPEQDIQGKIATVLAVVRDISQL
RLAELRLASLNKQLRQLMSSRESAREEERKLIAQEIHDELGQHLTAIRMGTSLLRFQYGE
QLPQLSEQVARLLQLIDQTVQVVRNISTSLRPSILNMGIVASLEWLTDTFKQQWGIDCNL
QVPAQKIRLDDASATAAFRIAQESLTNIARHAEATRVDIRFEQGEHDWSLEITDNGKGFE
QREQSSRTLGLLGMRERGLTLGGTTTISSTPGSGTTVQLRVPASRSQDS