Protein Info for AO356_28575 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 314 (204 residues), 74.8 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 36% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 96% identity to pba:PSEBR_c2g53)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9XG62 at UniProt or InterPro

Protein Sequence (320 amino acids)

>AO356_28575 ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MSVSTTLVPDDEYLPARETPVQRRRVRAAWLFLTPMLLCLALVAAWPLLRTFWFSLTDAS
LADTGDATFVGLSNYLFHSSAGWSGLLVDPQWWNAVRNTLHFTVVSVGLEIVLGLLVALL
LNVRFSGRALVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLMLGLGLIDAPLAWTAD
ADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHPVKVFWRVTLPLLMP
ALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLV
VAVIAMVYLYLGRRQLEVRS