Protein Info for AO356_27320 in Pseudomonas fluorescens FW300-N2C3

Annotation: MFS transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 276 (248 residues), 127.3 bits, see alignment E=3.5e-41

Best Hits

Swiss-Prot: 48% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3041)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X533 at UniProt or InterPro

Protein Sequence (433 amino acids)

>AO356_27320 MFS transporter permease (Pseudomonas fluorescens FW300-N2C3)
MMTTMTLDTVSTVRSSAYRKTAWRLMPFLMLCYLCAYLDRVNVGFAKLQMMNDLALSETV
YGLGAGMFFLGYFLCEVPSNLILHKVGARRWIARIMISWGIISALFAFVETAWQFYTLRF
LLGIAEAGLAPGLLLYLTYWFPSYRRAKMTVLWFIAIPLSGMIGGPLSGWIMTQFAGVHG
WAGWQWMFVIEAAPTVIVGLMVLAYLKDGVHQATWLTDEEKALVAKELAEDNSRKVTHAS
VGAFLRDRRLWILAGIYFCVVMGQYAITFWLPTLIRNAGVADPMHIGLLTSLPYLCAIIA
MVLMGRSGDKHQERRWHLVGPMLAGALGLTLAAVFGANLTLSVLCLCLAAAGVLSASSLF
WMLPTTLLGGVSAAAGIAGINSFANLAGFCSPYLIGWITTTTGSSAIGMYLITGVLCIGA
CLVLRIPAASVNR