Protein Info for AO356_26575 in Pseudomonas fluorescens FW300-N2C3

Annotation: low temperature requirement protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details amino acids 323 to 340 (18 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details PF06772: LtrA" amino acids 12 to 344 (333 residues), 221.9 bits, see alignment E=7.6e-70

Best Hits

KEGG orthology group: None (inferred from 89% identity to ppf:Pput_1984)

Predicted SEED Role

"low temperature requirement A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X1F9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>AO356_26575 low temperature requirement protein A (Pseudomonas fluorescens FW300-N2C3)
MKSLKYYEKNRRATWLELFFDLTFVVTIGKVTHTLGHVHQGHFEHDQLWTFLLIFVPLWW
IWSSHTIYSNRFDTDSNLHRLATLFIMLLLIVASARIGEDLEVNYPLVIACYFGIRAIIS
IMYISSISKLDSRNEFSSKLGFALLISAVVSLSSILFDPPVRYLVAYTGILLDILFPVFF
WTKLKPLPAHTEHLVERVGLLTLILLGESVISLSGGLSDIQWDRYNVMAAITGFIMICSI
WWIYFDSFYLLSKNESSMTGHSLIYSHLFLFLGLALLANLIRHAILNDIAMRDFQITSII
GMALFFLGKQYGYFRAVPKIRKYILQNTLIVFSLGGLVIFLPRVEYILVGLTATMICYVL
LNFRYR