Protein Info for AO356_26535 in Pseudomonas fluorescens FW300-N2C3

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 9 to 530 (522 residues), 315.1 bits, see alignment E=4.4e-98 PF00664: ABC_membrane" amino acids 18 to 178 (161 residues), 43.8 bits, see alignment E=2.7e-15 PF00005: ABC_tran" amino acids 346 to 479 (134 residues), 82.3 bits, see alignment E=5.3e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X3W8 at UniProt or InterPro

Protein Sequence (537 amino acids)

>AO356_26535 superoxide dismutase (Pseudomonas fluorescens FW300-N2C3)
MQTGILIVSRERASWLVFCVIAGLASSCAVILAIREIALVLADAGSGPAFSWRIFLIALA
VSILGGLSSQLALGHLGVRLVHELRLHVAQRILQLPYREYEQQGFSRMYAMLSDDVTKAS
TALGTLPMCVVCIGLVVFGLGYLLLLSPWHFALVAVVLFLGIVIARYASARTSRALREVR
ALEDQMQDLYRAMIEGAKEFRFSTRRRRDFLASVLSPLSSRLASRKQASGALWSVTVQWN
NLVFFLLLAVVAILPRHMPISDASTMTTYALVLLLLRAPIMALMELVPTVLAGKVALDRL
AQLDVAHSASSAEEPSVTPSIRTLALRSVCFDYAAEPGEAGVRLGPIDLSLRSGKIIFIT
GGNGSGKTTLAKLLSGLYAPSEGSVLLDGVELKPDVTTVLRHYASAIFSDFFVLPYEGQR
SNVAIDLASWEKRLGLDDKLSAASEWRSAPRLSQGQRKRLALLNLVAQDKPVCLFDEWAA
DQDKDYRDLFYRQLLRELAAKDKIVIVVSHDTDYFFVADIVIHMKDLKVTHIEEKDQ