Protein Info for AO356_25360 in Pseudomonas fluorescens FW300-N2C3

Annotation: dimethylmenaquinone methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03737: RraA-like
  • amino acids 22 to 166 (145 residues), 121.6 bits, E=1.7e-39

Best Hits

Swiss-Prot: 36% identical to LIGK_SPHSK: 4-carboxy-4-hydroxy-2-oxoadipate aldolase (ligK) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 70% identity to app:CAP2UW1_2989)

MetaCyc: 34% identical to 4-oxalocitramalate aldolase subunit (Pseudomonas straminea)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]; Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 4.1.3.17, 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

"Demethylmenaquinone methyltransferase"

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• gluconeogenesis I (11/13 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• glyoxylate cycle (5/6 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• D-malate degradation (1/1 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• 4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
• malate/L-aspartate shuttle pathway (1/2 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• gluconeogenesis III (8/12 steps found)
• chitin deacetylation (2/4 steps found)
• gallate degradation I (2/4 steps found)
• gentisate degradation II (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• L-carnitine degradation II (1/3 steps found)
• TCA cycle III (animals) (6/10 steps found)
• methylgallate degradation (3/6 steps found)
• gallate degradation II (2/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (4/8 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• superpathway of vanillin and vanillate degradation (5/10 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• reductive TCA cycle II (5/12 steps found)
• methylaspartate cycle (10/19 steps found)
• pyruvate fermentation to propanoate I (1/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• syringate degradation (4/12 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Carbon fixation in photosynthetic organisms
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40, 1.1.1.83

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112 or 4.1.3.17

Sequence Analysis Tools

See A0A0N9X4N9 at UniProt or InterPro

Protein Sequence (212 amino acids)

>AO356_25360 dimethylmenaquinone methyltransferase (Pseudomonas fluorescens FW300-N2C3)
MTTLLFPKDFHARAKVLGSSTLYEACHQPCAVDSAIRPVWDGAFIAAPAYPLECSPGDNL
ALHLAMERVPRGSVLVVGTGSFIAGYWGEVLTVAAETAGVVGLVIDGGVRDIAALKRRRF
PVFARGISVKGTVKASAPSVGQPFNFNGAHVAQGDLVVADEDGVIIIPKADVARTLAEGE
ARANKEAQMMQALTEGRSTLELMNLTEWRTRA