Protein Info for AO356_23850 in Pseudomonas fluorescens FW300-N2C3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 170 to 189 (20 residues), see Phobius details PF08521: 2CSK_N" amino acids 17 to 161 (145 residues), 25.7 bits, see alignment E=2.2e-09 PF00512: HisKA" amino acids 239 to 302 (64 residues), 54.3 bits, see alignment E=2.3e-18 PF02518: HATPase_c" amino acids 350 to 452 (103 residues), 87.6 bits, see alignment E=1.6e-28 PF13581: HATPase_c_2" amino acids 357 to 436 (80 residues), 33.2 bits, see alignment E=9.5e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2506)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W7P2 at UniProt or InterPro

Protein Sequence (455 amino acids)

>AO356_23850 histidine kinase (Pseudomonas fluorescens FW300-N2C3)
MSSIRRRTLTLILGLLFLGLLIITVFNLHDSNHEIAEVYDAQLAQNARLLQGVMRMPMAS
KEHAELYQAFNSALGQAVPKVDGHPYESKIAFQVWNSQGSVLVHTTSAPSFTSPPVAPGF
SEIVDQKNRKWRAFVLDDAQYGLKIWVGERDDVRADLVDRIVRHTVVPNLIGSVVLAAVI
WLAIGWGLKPLVDMAAKLRARHPGSLEPLQMMPLPTELEPMQAALNRVLAQIQEVMGRER
RFIADAAHEMRTPLAVLRVHAQNLMEAGSEQSRRESLEHLIAGVDRTTRLVNQLLTMARL
EPQAGVPTPAVIDLAATVRASLVQMTPWLLSKGLEPVLDVSDDIGPVRIDPVAIDIALNN
LVTNAANFSPANGTITVRLARKGDHYELSVEDQGPGIDEAERERLFERFYSRGNDQGAGL
GLTIVRTIADRLGGHIRLENRTEGGLCATLEIGRF