Protein Info for AO356_22845 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)
Rationale: Specifically important for utilizing L-Phenylalanine. Automated validation from mutant phenotype: the predicted function (1.13.11.27) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF14696: Glyoxalase_5" amino acids 5 to 142 (138 residues), 230.8 bits, see alignment E=8.6e-73 TIGR01263: 4-hydroxyphenylpyruvate dioxygenase" amino acids 12 to 355 (344 residues), 417.8 bits, see alignment E=2.4e-129 PF00903: Glyoxalase" amino acids 160 to 276 (117 residues), 64.3 bits, see alignment E=2.2e-21

Best Hits

Swiss-Prot: 97% identical to HPPD_PSEUJ: 4-hydroxyphenylpyruvate dioxygenase (hpd) from Pseudomonas sp. (strain P.J. 874)

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 99% identity to pba:PSEBR_a3406)

MetaCyc: 97% identical to 4-hydroxyphenylpyruvate dioxygenase subunit (Pseudomonas sp. P.J. 874)
4-hydroxyphenylpyruvate dioxygenase. [EC: 1.13.11.27]

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X2S6 at UniProt or InterPro

Protein Sequence (358 amino acids)

>AO356_22845 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (Pseudomonas fluorescens FW300-N2C3)
MADLYENPMGLMGFEFIEFASPTPNTLEPIFEIMGFTKVATHRSKDVHLYRQGAINLILN
NEPHSVASYFAAEHGPSVCGMAFRVKDSQLAYKRALELGAQPIHIETGPMELNLPAIKGI
GGAPLYLIDRFGEGSSIYDIDFVFLEGVDRNPVGAGLKIIDHLTHNVYRGRMAYWAGFYE
KLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQ
HVAFLTDDLIKTWDHLKSIGMRFMTAPPDTYYEMLEGRLPNHGEPVNELQSRGILLDGAS
EQGDKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLATE