Protein Info for AO356_19910 in Pseudomonas fluorescens FW300-N2C3
Annotation: cystathionine gamma-synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a4100)Predicted SEED Role
"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- glycine betaine degradation III (7/7 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
- D-serine degradation (3/3 steps found)
- L-cysteine degradation II (3/3 steps found)
- L-methionine degradation II (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
- L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
- superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
- glycine betaine degradation I (6/8 steps found)
- homocysteine and cysteine interconversion (3/4 steps found)
- superpathway of L-threonine metabolism (13/18 steps found)
- L-tryptophan degradation II (via pyruvate) (2/3 steps found)
- L-threonine degradation I (4/6 steps found)
- hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
- purine nucleobases degradation II (anaerobic) (16/24 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
- superpathway of L-methionine salvage and degradation (9/16 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- hypoglycin biosynthesis (4/14 steps found)
KEGG Metabolic Maps
- Cysteine metabolism
- Glycine, serine and threonine metabolism
- Methionine metabolism
- Nitrogen metabolism
- Selenoamino acid metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.4.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WKZ0 at UniProt or InterPro
Protein Sequence (381 amino acids)
>AO356_19910 cystathionine gamma-synthase (Pseudomonas fluorescens FW300-N2C3) MKVSTEILHIKVDDRDAHPSVTPIYQCSAFNADSAFFYSRKANPNVTELEQVVASLEGSE HALAYSTGMSAIYMVLELLKPGASLVINKYIYGCSYKLFQRYAARIGAHLTILDLTTAEG LKALPANVDMVIFETPTNPFLKDIDIHAVSRAVKQHNPQALVVVDNTWATPIFQKPLNFG ADISLYSATKYFSGHSDVMGGLVLVNNETIYNRLLEGRFYSGTILTPNSAWLLRRSMQTF NLRMEKHSQTTASMLNYLRELPFIEHVYYPRIDGRQLSGYGGIVFVDIRPDLVPFYKTFT SALKWFGTGTGMACVTSMVAQPFSGSHASMTDQEKADMGIEKGLVRLCFGLEDIEDLKED LLQAFETMESKVDQKSSLDPA