Protein Info for AO356_19860 in Pseudomonas fluorescens FW300-N2C3

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 200 (193 residues), 189.1 bits, see alignment E=9.5e-60 PF08659: KR" amino acids 11 to 163 (153 residues), 36.7 bits, see alignment E=6.2e-13 PF13561: adh_short_C2" amino acids 15 to 251 (237 residues), 237.3 bits, see alignment E=2.8e-74

Best Hits

Swiss-Prot: 40% identical to Y325_THEMA: Uncharacterized oxidoreductase TM_0325 (TM_0325) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a4106)

MetaCyc: 40% identical to cyclohexanol dehydrogenase (Acinetobacter sp. SE19)
Cyclohexanol dehydrogenase. [EC: 1.1.1.245]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.245

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9XC34 at UniProt or InterPro

Protein Sequence (253 amino acids)

>AO356_19860 short-chain dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MSMTFSGQVAVVTGGAAGIGCATAQAFAAEGLKVVVADLDVAGGERTVQSIRDGGGEALF
VRCNVTLESDVQHLMDEVIKAYGRLDYAFNNAGIEIEKGKLADGTLDEFDAIMGVNVKGV
WLCMKYQLPLLLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYARKKI
RVNAVCPAVIDTDMFRRAYEADPKKGEFANAMHPVGRIGKVEEIASAVLYLCSDGAAFTT
GHSLAVDGGVTAF