Protein Info for AO356_18880 in Pseudomonas fluorescens FW300-N2C3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 354 to 371 (18 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 298 (288 residues), 80.5 bits, see alignment E=1.2e-26 amino acids 270 to 373 (104 residues), 41.1 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a4294)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WXZ8 at UniProt or InterPro

Protein Sequence (453 amino acids)

>AO356_18880 MFS transporter (Pseudomonas fluorescens FW300-N2C3)
MRQIWKPFRALYFASLMMLIGSGLLSTYLALRLAADHVDSLWVGALMAANYFGLVLGGKI
GHRLIARVGHIRAYSACAGIVGAAVLGHGLVDWLPAWIVLRMIVGLGMMCQYMVIESWLN
EQADAKQRGVVFSGYMIASYLGLVLGQLILVMHPALGLELLMLVALCFALCLVPVTLTRR
IHPAALHPAPMEPRFFIKRVPQSLSTVLGSGLIVGSFYGLAPLYASQQGLSTEQVGLFMG
SCIFAGLLVQWPLGWLSDRYDRALLIRCFALVLTICALPLAILPAVPLEVLFVAGFFCSL
VQFCLYPLAVAFSNDHVEADRRVSLTAMLLVTYGVGASIGPLVAGVLMKMFGSQMLYGFF
AFFALVLVWRIRPKAVTNLHQVDDAPLHHVAMPDSMSSSPLVACLDPRVDEQVVQEQMQA
PASPEMEPEPATETVAEADAEAPEAPSFTQARP