Protein Info for AO356_16010 in Pseudomonas fluorescens FW300-N2C3

Annotation: type II secretion system protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 171 to 192 (22 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details PF00482: T2SSF" amino acids 71 to 194 (124 residues), 120.4 bits, see alignment E=2.3e-39 amino acids 276 to 397 (122 residues), 110.3 bits, see alignment E=3.2e-36

Best Hits

Swiss-Prot: 74% identical to PILC_PSEAE: Type 4 fimbrial assembly protein PilC (pilC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 95% identity to pba:PSEBR_a4827)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJ55 at UniProt or InterPro

Protein Sequence (405 amino acids)

>AO356_16010 type II secretion system protein F (Pseudomonas fluorescens FW300-N2C3)
MAVKAVKTDVYTWEGKDRKGAKMTGELTGQSPALVKAQLRKQGINPEKVRKKSTSIFSKG
KRIKPLDIALFTRQMATMLKAGVPLLQAFDIIGEGFDNANMRKLVDQVKQEVAAGNSFAA
SLRKCPQYFDDLYCNLVDAGEQAGALDTLLDRVATYKEKSEALKAKIKKAMTYPTAVILV
AAVVTGILLVKVVPQFESVFSGFGAQLPAFTVMVIGLSEFLQDWWWVVLGGLVGTFFGVK
YALRRSERFRDWRDKWLLKLPLIGALMYKSAVARYARTLSTTFAAGVPLVEALDSVSGAT
GNVVFKRAVQRIRQDVSTGMQLNFSMRASGIFPNLAIQMTAIGEESGALDDMLDKVASFY
EAEVDNLVDNLTSLMEPFIMVILGVVVGGLVVAMYLPIFQLGSAI