Protein Info for AO356_14070 in Pseudomonas fluorescens FW300-N2C3

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 812 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07660: STN" amino acids 63 to 110 (48 residues), 29.9 bits, see alignment 5.8e-11 PF07715: Plug" amino acids 156 to 254 (99 residues), 79.2 bits, see alignment E=4.7e-26 TIGR01783: TonB-dependent siderophore receptor" amino acids 157 to 811 (655 residues), 421.5 bits, see alignment E=3.4e-130 PF00593: TonB_dep_Rec" amino acids 327 to 782 (456 residues), 218.6 bits, see alignment E=4.7e-68

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 98% identity to pba:PSEBR_a5195)

Predicted SEED Role

"Ferrichrome-iron receptor @ Ferric siderophore receptor, TonB dependent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WXI8 at UniProt or InterPro

Protein Sequence (812 amino acids)

>AO356_14070 TonB-dependent receptor (Pseudomonas fluorescens FW300-N2C3)
MSRPLDTLLRPSLLAVAIAFAVPLTSAPLLAAEQTTSVRTYNLPAAPLASTLNQIASQAG
LALSLNPSLASGKTSAPVQGQFDATGALREALRGTGLQLEQSSAGTYSLVALPEGVMALP
ETSVIGAGLSETAWGPTESYVATRTAAGTKTDTPIVELPRSVSVVTRQQMEDRSVLNLND
ALRYTAGVQSSGYGSDSRNDWLLVRGFVPTQFLDGLPLPKGNYITPKIEPWNLERIAVLR
GPASSVYGQTPPGGMLDMVSRRPQAESSHEVELQAGSYEHKQINFDSTGKVDDEGQFLYR
VSGTVRDSNSQVDHIPDKRYNLAPSLTWNINDDTRLTFLSQYTRDDTGITGQFLPLQGTK
LSSPAGKISHHKNLGDPDWEFYDRTYYALGYAFEHRLNDTWQFRQNLRYTKSDLETQGIS
AGGQFWPAGPEEAVSADGTIKRSASVVDEDISQFAVDNNFQADFQTGALNHTLLLGLDHQ
RSNSNSRWLWGSTGVPTSNIHNPTYGQDFSNVQYFTMYDYNQKTNQTGLYVQDQIALDNW
RLTLGGREDWIHTGTEFHNQNNVTNTQRDKKFSGNAALSYVFDNGVTPYISFAQSFQAAA
GSTVNSTEAFKPTEGEQYEAGIKYQPPGTKTLLTAAVFDLTQKNNSVTENNVTRQVGEVQ
VRGLELEASGDVTDNLKLIGSYTYNDSEITKGTAAEKGKRMAQVPRNQATAWADYTWHNG
PLDGFGVGAGVRYVGDTYGNTTNTDWGHVGSYTVYDASAHYDLGRLNKTLKGVTVAVDAK
NIFNKDYLSTCDGFYCYYGDQRNVVASVNYKW