Protein Info for AO356_12160 in Pseudomonas fluorescens FW300-N2C3

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF00158: Sigma54_activat" amino acids 196 to 363 (168 residues), 239.5 bits, see alignment E=3.4e-75 PF14532: Sigma54_activ_2" amino acids 197 to 367 (171 residues), 81.6 bits, see alignment E=1.4e-26 PF07728: AAA_5" amino acids 220 to 339 (120 residues), 27 bits, see alignment E=8.3e-10 PF02954: HTH_8" amino acids 456 to 495 (40 residues), 48.4 bits, see alignment 1.3e-16

Best Hits

KEGG orthology group: K11914, sigma-54 dependent transcriptional regulator (inferred from 75% identity to pfo:Pfl01_5583)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W7S4 at UniProt or InterPro

Protein Sequence (505 amino acids)

>AO356_12160 Fis family transcriptional regulator (Pseudomonas fluorescens FW300-N2C3)
MFKTLSQPLDYAEALLAQFFSLSRLADGAVLVGDFLQGVARLSGCELVQLYVLDATGTRL
EMNTECLEGQLQFRDPQSLPSDYRAEQLLQFSLGQNRVVCLGALGDSVHETRFLPARATP
WQSLLCVPLVDPQGRVGGLLLCASDQHLDLHGVAESLGQLGAFALGQMHLLQRLQRPVDE
PVSVTSSLPSGISYGLIGKSVAMRKTCSLISKVLHSPYTVLLRGETGTGKEVVARALHDH
GPRRSKAFIVQNCAAVPENLLESELFGYRKGAFTGADRDRAGLFDAANGGTLLLDEIGDM
PLSLQAKLLRVLQEGEIRPLGSNDTHHVDVRIVAATHRDLKQLMEEGKFREDLYYRLAQF
PIQLPALCQRDGDIIELARHFAEKACALLQRDPVRWSEAALDHLAAYGFPGNVRELKSVV
ERAVLLCESGELLIEHFALHIEPPSERGRINLRERMEQIERGLLIDCLREHSGNKTRAAR
ELGLPLRTLIYRLARLNVQRSDFND