Protein Info for AO356_11100 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): L-asparaginase (EC 3.5.1.1)
Rationale: Specifically important for utilizing L-Asparagine. Automated validation from mutant phenotype: the predicted function (ASPARAGHYD-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: asparaginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00710: Asparaginase" amino acids 11 to 183 (173 residues), 139.7 bits, see alignment E=8.8e-45 PF17763: Asparaginase_C" amino acids 209 to 324 (116 residues), 95.2 bits, see alignment E=2.6e-31

Best Hits

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 96% identity to pba:PSEBR_a107)

Predicted SEED Role

"L-asparaginase (EC 3.5.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W267 at UniProt or InterPro

Protein Sequence (334 amino acids)

>AO356_11100 L-asparaginase (EC 3.5.1.1) (Pseudomonas fluorescens FW300-N2C3)
MNPSTYPAAQHVMVLYTGGTIGMQASAHGLAPASGFEARMRDYLHSQPELVVPQWRFREM
SPLIDSANMTPAYWQQLREAVVDAVDVQGCDSVLILHGTDTLAYSAAAMSFQLLGLHARV
CFTGSMLPAGVTDSDAWENLSGALVALGQGLAPGVHLYFHGELLAPTRCAKVRSFGRHPF
KRLERQGGGTPAPTLPTQLNYNQPKQLTNIAALPLFPGISAQILDGLLGSGIQGLVLECY
GSGTGPSDNPAFLASLERARDSGVVVVAVTQCHEGGVELDVYEAGSRLRGVGVLSGGGMT
REAALGKLQALIGAGLPVEEVRRLVELDLCGELI