Protein Info for AO356_10875 in Pseudomonas fluorescens FW300-N2C3

Annotation: acetyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF02550: AcetylCoA_hydro" amino acids 12 to 215 (204 residues), 96.1 bits, see alignment E=4.4e-31 TIGR03458: succinate CoA transferase" amino acids 13 to 494 (482 residues), 765.7 bits, see alignment E=9.1e-235 PF13336: AcetylCoA_hyd_C" amino acids 322 to 463 (142 residues), 139.2 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: K01067, acetyl-CoA hydrolase [EC: 3.1.2.1] (inferred from 97% identity to pba:PSEBR_a151)

Predicted SEED Role

"Acetyl-CoA hydrolase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WUL4 at UniProt or InterPro

Protein Sequence (497 amino acids)

>AO356_10875 acetyl-CoA hydrolase (Pseudomonas fluorescens FW300-N2C3)
MYRDRIRLPSLLNKVMSAAEAALLIQDGMTVGMSGFTRAGEAKAVPHALAERAKVTPLKI
SLMTGASLGNDLDKELTEAGVLARRMPFQVDSTLRKAINAGKVMFIDQHLSETVEQLRNG
QLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFARQVIVEINLAHNPNLEGLHDIYI
PTYRPTRTPIPLVKVDDRIGSPAIAIPPEKIAAIVITNQGDSPSTVAPPDSDTQAIADHL
IDFFKQEVSAGRMTNKLGPLQAGIGNIANAVMCGLIDSPFEDLTMYSEVLQDSTFDLIDA
GKLSFASGSSITLSDRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIAINTALEF
DLYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAIFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEIGLADLRGLAPRERARVIIDNCVHPTYHQALNEYFDAACALGGHTPHILRD
ALSWHLNLEETGRMLAV