Protein Info for AO356_10655 in Pseudomonas fluorescens FW300-N2C3

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 PF01494: FAD_binding_3" amino acids 6 to 49 (44 residues), 23.9 bits, see alignment 4.8e-09 PF13450: NAD_binding_8" amino acids 10 to 39 (30 residues), 25.1 bits, see alignment (E = 3.5e-09) PF00732: GMC_oxred_N" amino acids 240 to 351 (112 residues), 27.3 bits, see alignment E=6.3e-10 PF05199: GMC_oxred_C" amino acids 484 to 601 (118 residues), 67.4 bits, see alignment E=4.1e-22

Best Hits

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W1X9 at UniProt or InterPro

Protein Sequence (739 amino acids)

>AO356_10655 dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MSTEQAEVIIVGAGLAGSIIAYQLGMAGVDVLVLESGPEVPANRAQYLERFYTATLKTPE
SPYPPVSTLNSPRDPSKENAPRATIADLLGGWNKPKTSYLVQKGPLPFNSTYERVGGGTT
WHWVGTCLRMLPNDFRLKSKYGVGVDWPISYDDLQSAYCRAEAEIGVSANVADQAYLGMT
FPEGYSFPMHSIPLSLVDGSFVAAVTGKSFDGLPLVVSPTPAGRNSQPYAGRRVCAGNTN
CTPICPIQAKYDATVTLNKALATGKVRVMYRTVASKVTVGPDKNINGVEFIQYQLGEGPK
TGSGVAIGQRYVIAAHAIETPKLLLNSKTPAWPDGVANSSHQVGCSLSDHPIYLAWGLMP
EGKTVFPYRGPVSTAGIESLRDGDFRSQRAAWRIEIGNEGWNWPVGDPYVTVVDFIDGKN
ISRTNPLPSKKDTQPTEVLYGTALIQRLNDLFIRQFRIAFLVEQVEKDPDKAKSYIVPST
DKLTDGLGILRPEIHYELSDYTREGFRRAKILASHIIKDLLGAEELTAPIGEGKFTHLKE
DYTFQGAGHLMGTYRMGDDPTKSVVDKYQRSWDHKNLFLVGDGVFPSTGTSNPSLTIAAL
SFQAGDTIANDLKAVTMQVQSNIAWQGTGVQVNGLVPRLVRYVSGLWCASPQGGNVDGNG
GSRHIDYSSYALPGAAEGALIGRVGAGGTPFLVGDLAQVPGNQQGELQLCINDDLTGQYG
SGLKDNTGALTIRVEFGAL