Protein Info for AO356_09255 in Pseudomonas fluorescens FW300-N2C3

Annotation: glycine/betaine ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 51 to 290 (240 residues), 347.4 bits, see alignment E=4.9e-108 PF00005: ABC_tran" amino acids 54 to 201 (148 residues), 121.8 bits, see alignment E=4.8e-39

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 89% identity to pba:PSEBR_a3618)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1V4 at UniProt or InterPro

Protein Sequence (372 amino acids)

>AO356_09255 glycine/betaine ABC transporter (Pseudomonas fluorescens FW300-N2C3)
MTTAKIDTNEVLVDCQNVWKIFGESAPAAMQAVVQQGLTKTRILQDYSCVVGVSNVSLQV
RRGEIFCIMGLSGSGKSTLIRLLNKLITPSSGKVLVKGKDLSTLSAAQLREVRARHIGMV
FQSVALLPNRTVLENTAFGLEVQGIGKAERYKVAERALAKVGLSEWSQRYPSELSGGMQQ
RVGLARAITADPEVILMDEPFSALDPLIRRQLQDEFRQLTKELGKSAVFITHDLDEAIRI
GDRIAIMKDGVIIQVGTAEEIVLKPADDYVAEFVAGISRLHLVKAHSVMTPVAPFKAANP
GCDIARLIKTRLDADINELIGLTVKSERDALAVVDNDVVVGIITPRDLLRGVQGIANEFS
ASSATAALEASA