Protein Info for AO356_09040 in Pseudomonas fluorescens FW300-N2C3

Annotation: potassium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 387 (373 residues), 196.9 bits, see alignment E=7.7e-62 PF02080: TrkA_C" amino acids 415 to 482 (68 residues), 53.5 bits, see alignment E=2.8e-18 PF03471: CorC_HlyC" amino acids 495 to 568 (74 residues), 48.7 bits, see alignment E=9.1e-17

Best Hits

Swiss-Prot: 93% identical to NHAP2_PSEPF: K(+)/H(+) antiporter NhaP2 (nhaP2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 98% identity to pba:PSEBR_a468)

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WG94 at UniProt or InterPro

Protein Sequence (580 amino acids)

>AO356_09040 potassium:proton antiporter (Pseudomonas fluorescens FW300-N2C3)
LTAATINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMVAGVDGAGILFDNYATA
YLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATVGVLITTGLTGLAAAWLFNLNLIQ
GLLIGAIVGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIGMLASGET
GLHWSLLGHLLREFGIGSVLGLGGGWLMLQLVNRINLANGLYPILVISGGLAVFALTNAL
HGSGFLAVYLCGLVIGNRPVRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIALP
ALGLALWMILFARPLSVIVGLLPFKAFHGREKAFISWVGLRGAVPIILAVFPLMAGLPHA
QLYFNLAFFIVLVSLLVQGTSLPWVAKLLHVTVPPEPLPISRAALEVHVTSEWELFIYRL
GAEKWCIGSPLRDLKMPEGTRIAALFRGQQLLHPSGSTVLEVDDLLCVIGHEHDLPALGK
LFSQAPQRGLDLRFFGDFVLEGDAQLAAVAALYGLKLDGIDPDMSLGRFIAQKVGGAPVV
GDQVDWNNTLWTVAAMDGNKIGKVGVRFPEGSRPGPGLFL