Protein Info for AO356_08475 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00106: adh_short" amino acids 5 to 189 (185 residues), 164.6 bits, see alignment E=3e-52 PF08659: KR" amino acids 5 to 164 (160 residues), 56.2 bits, see alignment E=6.3e-19 PF13561: adh_short_C2" amino acids 9 to 224 (216 residues), 119 bits, see alignment E=3.7e-38

Best Hits

Swiss-Prot: 60% identical to ISFD2_CHRSD: Sulfoacetaldehyde reductase 2 (isfD2) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a575)

MetaCyc: 60% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1T5 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AO356_08475 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MSDTLFITGATSGFGEACARRFAEAGWKLVLTGRREERLNALCAELSKQTEVHGLVLDVR
DRKAMEEAIANLPPSFAKLRGLINNAGLALGVDPAPKCDLDDWDTMVDTNVKGLIYSTRL
LLPRLIAHGRGAGIVNLGSIAGNYPYPGSHVYGASKAFVKQFSLNLRCDLQGTGVRVSNI
EPGLCESEFSLVRFGGDQERYNATYAGAEPIQPQDIADTIFWVLNAPAHININSLELMPV
SQTWAGFAIERNKT