Protein Info for AO356_08325 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): predicted copper homeostasis protein
Rationale: PFam PF11162.4 (DUF2946). conserved cofit with TonB-dependent copper receptor (AO356_08330), and cofit with copper chaperone CopZ (AO356_08320)
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF11162: DUF2946" amino acids 8 to 131 (124 residues), 76.8 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 76% identity to pba:PSEBR_a610)

Predicted SEED Role

"Putative multicopper oxidases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W0Z6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>AO356_08325 predicted copper homeostasis protein (Pseudomonas fluorescens FW300-N2C3)
MSQTRGSWISLFAMLMIFIGPLISQSMPMDQRMPASMNMSMSMDMSMDMPAGVHAEHEAS
TDEHCPPQREHHALWEKCGYCSLLFNCPALTGGQGFATFETPLANTYTAPSPRLGHARTA
FFPGARTRAPPLDA