Protein Info for AO356_03515 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 819 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 250 to 366 (117 residues), 46.8 bits, see alignment E=3e-16 PF13188: PAS_8" amino acids 251 to 304 (54 residues), 21.7 bits, see alignment 4.4e-08 PF00989: PAS" amino acids 251 to 360 (110 residues), 44.6 bits, see alignment E=4e-15 PF08448: PAS_4" amino acids 252 to 365 (114 residues), 38 bits, see alignment E=5.3e-13 PF13426: PAS_9" amino acids 256 to 362 (107 residues), 31.6 bits, see alignment E=5.1e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 370 to 534 (165 residues), 144.6 bits, see alignment E=2.3e-46 PF00990: GGDEF" amino acids 374 to 531 (158 residues), 154.2 bits, see alignment E=8.1e-49 PF00563: EAL" amino acids 553 to 792 (240 residues), 204.2 bits, see alignment E=6e-64

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1540)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WTL2 at UniProt or InterPro

Protein Sequence (819 amino acids)

>AO356_03515 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MKQKQTLGTPRLLGIVWPFIAVVLFQALLGGVSLYVLSAVRGYVAGESLWSKGQKDAIYY
LNLYADSRDEAIFRKYQQAIAVPEGGHELRVALDRQPPNLEAARAGILKGGNHPDDVASV
IWLYLNFRHFSYLEEAIDLWTVGDGYLTELDNVARQMHSSIVAGQASEVDIRGWKAQIFA
INDSVTPAAKAFSDALGEGSRFILRLLLVTNFATALGLIVLALLRTHKLLAQRQVFANAL
QMEKERAQITLQSIGDGVITTDVEGGIAYMNPAAEAMTHWKAEHATGLPLAALFNLLDDN
AQTEGLTLIEHILSGRLSGASEHSKLIQRLDGSTVSVTLVGAPIRHAGKVSGAVLVLHDM
TQERQYIANLSWQATHDALTGLANRREFEYRLEQALHNLTRQIGRHALMFLDLDQFKLVN
DTCGHAAGDELLRHICALLQSGLRENDTLARLGGDEFGILLENCSPEAAEKIAEGLRQTV
QNLHFVWKGRPFVTTVSIGLVHIAQTPTTLEASLRAADMACYMAKEKGRNRVQVYHADDS
ELSLRFGEMAWVQRLHMALEENRFCLYAQEIAALGPGDHGGGHIEILLRLHDEAGRMILP
DSFIPAAERYGLMTSLDRWVVENVFKIIRQCLNESRQGPMAMCAINLSGTTIGDQAFLDF
LRKQFVAYSIPPEMICFEITETSAISNLGSAIRFINELKSLGCYFSLDDFCAGMSSFAYL
KHLPVDFLKIDGSFVKDMLDDPINRAMVEVINHIGHVMGKRTIAEFVETAQIEQALLEIG
VDFAQGYVIERPQLFTCDTLQCRPARPQPLLFKAPGTFR