Protein Info for AO356_03485 in Pseudomonas fluorescens FW300-N2C3

Annotation: N-ethylammeline chlorohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01979: Amidohydro_1" amino acids 64 to 412 (349 residues), 239.7 bits, see alignment E=5.8e-75 PF07969: Amidohydro_3" amino acids 200 to 412 (213 residues), 60.9 bits, see alignment E=1.7e-20

Best Hits

Swiss-Prot: 54% identical to MTAD_TERTT: 5-methylthioadenosine/S-adenosylhomocysteine deaminase (mtaD) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1546)

Predicted SEED Role

"S-adenosylhomocysteine deaminase (EC 3.5.4.28); Methylthioadenosine deaminase" (EC 3.5.4.28)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VYB7 at UniProt or InterPro

Protein Sequence (443 amino acids)

>AO356_03485 N-ethylammeline chlorohydrolase (Pseudomonas fluorescens FW300-N2C3)
MPKPAVALDLLLLPTWLVPVEPAGVVLKDHGLGIRDGCIVFIGPRAEALKCDATEVRELP
GMLLSPGLINAHGHAAMTLFRGLADDLPLMTWLEQHIWPAEAKWVDEDFVRDGTDLAIAE
QIKGGITCFSDMYFYPKIASECVHDSGIRAQIAIPILDFPIPGAASADDAIRQGIELFGD
LKHHPRIKVAFGPHAPYTVGDENLEKIRVIAEELDAAIHMHVHETAFEVQQAVDNTTERP
MARLGRLGLLGPRFQAVHMTQISDEDQALLVESNCSVIHCPESNLKLASGFCPVERLWQA
GVNVALGTDGAASNNDLDLLGETRTAALLAKAVAGSATALDAHRALRMATLNGARALGIE
ATVGSLEVGKAADLVAFDLSGLAQQPIYDPVSQLIYATGRDCVKHLWVGGKPLLEDGRLT
RMDEPTLIATAQAWGRRISGHNE