Protein Info for AO356_03315 in Pseudomonas fluorescens FW300-N2C3

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details amino acids 487 to 510 (24 residues), see Phobius details amino acids 530 to 554 (25 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 5 to 561 (557 residues), 722.4 bits, see alignment E=1.9e-221 PF03814: KdpA" amino acids 11 to 560 (550 residues), 786.6 bits, see alignment E=5.2e-241

Best Hits

Swiss-Prot: 91% identical to KDPA_PSEPF: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 98% identity to pba:PSEBR_a1586)

MetaCyc: 56% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQZ6 at UniProt or InterPro

Protein Sequence (564 amino acids)

>AO356_03315 ATPase (Pseudomonas fluorescens FW300-N2C3)
MHGYDYGLILAFFALVLIPAPFLGRFYYRVMEGQRTWLSPILGPVERGCYRLAGVDSRAE
QSWQKYTLAMLAFNLAGFVLLFAVLLLQGHLPLNTEQLPGMEWTQAFNTAVSFMTNTNWQ
SYSGEASLSYLSQMVGLTVQNFVSAATGLAVLVALCRGIGRKSATTLGNFWVDMTRATLY
GLLPLCLLLALFLVWQGVPQTFAHYVHGVTMQGADQVIPLGPAASQIAIKQLGTNGGGFF
GVNSAHPFENPTAWSNLFELASIILIPAALVFTFGHYVKDLRQSRAIIACMLALFLIGGA
TSLWAEYQPSPALNNPAVEQTAPLEGKETRFGTTATVLWSVTTTAASNGSVNAMHDSLNP
LSGMVALVNMMVGEVIFGGVGAGLYGMLLNVLIAVFLAGLMIGRTPEYLGKKLGAREVQL
LVATLLVMPVSVLVLGAVAASLPGPAAAVSNPGAHGFSQLLYAYTSAGANNGSAFGGFGA
NTPFHNLMLGLGMLIGRFGYILPVLALAGSLALKKSAPIGQNSFPTHGPLFVTLLTVTIL
LVGGLTFLPTLALGPIAEHLSMGF