Protein Info for AO356_02430 in Pseudomonas fluorescens FW300-N2C3

Annotation: cytochrome C oxidase Cbb3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF02433: FixO" amino acids 3 to 179 (177 residues), 268.2 bits, see alignment E=5.1e-84 TIGR00781: cytochrome c oxidase, cbb3-type, subunit II" amino acids 4 to 179 (176 residues), 273.7 bits, see alignment E=6.6e-86

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 99% identity to pba:PSEBR_a1726)

MetaCyc: 94% identical to cbb3-2 cytochrome c oxidase subunit O (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1E0 at UniProt or InterPro

Protein Sequence (202 amino acids)

>AO356_02430 cytochrome C oxidase Cbb3 (Pseudomonas fluorescens FW300-N2C3)
MKHEAVEKNIGLLAFFMVIAVSIGGLTQIVPLFFQDVTNKPVEGMKPRTALELEGRDIYI
ANGCVGCHSQMIRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGGRYSDDWQ
RAHLYNPRNVVPESKMPAYPFLVENKLDGKDTAKKMEVLRALGVPYTDEDIAGAKDAVKG
KTEMDALVAYLQGLGTIIKSKR