Protein Info for AO353_28240 in Pseudomonas fluorescens FW300-N2E3

Annotation: sarcosine oxidase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF01494: FAD_binding_3" amino acids 6 to 38 (33 residues), 22.9 bits, see alignment 1.9e-08 PF00890: FAD_binding_2" amino acids 7 to 39 (33 residues), 22.6 bits, see alignment 2.3e-08 PF01266: DAO" amino acids 7 to 355 (349 residues), 246.6 bits, see alignment E=2.2e-76 PF13450: NAD_binding_8" amino acids 10 to 48 (39 residues), 25.5 bits, see alignment 5.2e-09

Best Hits

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 92% identity to pfs:PFLU4041)

Predicted SEED Role

"Opine oxidase subunit B"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQN3 at UniProt or InterPro

Protein Sequence (384 amino acids)

>AO353_28240 sarcosine oxidase subunit beta (Pseudomonas fluorescens FW300-N2E3)
MTLQKADVVIVGGGLMGSAAAFFLRQRGQSVILLERDQIGQYASGVNFGNVRRQGRFLGQ
LELANRSWALWKRLPELIDDDLEFIASGHMRVCYREDEIAELEAYAAAPEAAQLDLKIYR
GAELHQRFPFLGPDVKGGSYAPHDGHANPRLAAPAFARAARRLGARIEEQTEVAEVQKVG
GEFTVTTTDGRQFSAEQLLITAGAWGQKLSAQFGEPVPLDTHGPQMAVTEPVPYALPTVI
GVYTKIPEEVIYFRQIPRGNIVIGGGYRSKPDMLNRRAQVEPRSILNQIQQMRRLLPGVG
NLNIIRVWSGIEGYMPDSLPVMGRSGTVDGLFYAFGFCGHGFQLGPGVGDVMAELISTGS
TNTSIEPFSIRRFALSAEQRSKAS