Protein Info for AO353_25705 in Pseudomonas fluorescens FW300-N2E3

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 82 to 106 (25 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details PF12625: Arabinose_bd" amino acids 28 to 204 (177 residues), 133.4 bits, see alignment E=1e-42 PF12833: HTH_18" amino acids 254 to 330 (77 residues), 64.2 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_2871)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VUI6 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AO353_25705 AraC family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MSEKDTISIHLVREALLQSCELSAVSTEVLLKVGIEPRSLSVAGARVPATAYARLWRLLA
RRMDDEFFGMDPRRLKSGSLEFLCRCAMAQPTLAAGLTAGLGFLSLMLERMPAQLVHQQS
LAEIVLLEDDQEPRRAFTYFTYWMIVHGVACWLAGRRIPILAIELRCAEPDFCDDYKVMF
SENLRFDRPRTRMIFSADCLDLPIKRSSDELKRFLAHAPANILVKYRDPQSLASRIKHDL
RHLPAEQWPETDSLAQRLCMSASTLRRRLAEEGQTYQGLKDSVRKELAIVWLAEPSISFA
EIATRLGFADASSFYKAFRKWSGSNPGHYRSLILNEAGQ