Protein Info for AO353_23525 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Catechol 1,2-dioxygenase (EC 1.13.11.1)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (CATECHOL-12-DIOXYGENASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: catechol 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02439: catechol 1,2-dioxygenase
  • amino acids 8 to 289 (282 residues), 461 bits, E=5.7e-143
• PF04444: Dioxygenase_N
  • amino acids 27 to 96 (70 residues), 81.2 bits, E=4e-27
• PF00775: Dioxygenase_C
  • amino acids 105 to 290 (186 residues), 250 bits, E=1.1e-78

Best Hits

Swiss-Prot: 59% identical to CATA_ACIAD: Catechol 1,2-dioxygenase (catA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03381, catechol 1,2-dioxygenase [EC: 1.13.11.1] (inferred from 91% identity to pfl:PFL_3860)

MetaCyc: 91% identical to catechol-1,2-dioxygenase (Pseudomonas reinekei)
Catechol 1,2-dioxygenase. [EC: 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (18/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.1

Sequence Analysis Tools

See A0A0N9WPJ5 at UniProt or InterPro

Protein Sequence (309 amino acids)

>AO353_23525 Catechol 1,2-dioxygenase (EC 1.13.11.1) (Pseudomonas fluorescens FW300-N2E3)
MNAKISHTASAQKFLEEASGLLNDAGNPRAKALIYRILRDSVNIIEDLEVTPEEFWKAVN
YLNELGARQEAGLLVAGLGLEHYLDLLMDAEDAQAGKTGGTPRTIEGPLYVAGAPLSNGE
ARLDDGVDPGVVLFMQGQVKNTDGKPLAGAVVDVWHANTGGTYSYFDGSQSEFNLRRRIV
TDAEGRYRFRSIVPSGYGCPPDGPTQQLLDQLGRHGQRPAHIHFFISADDHRHLTTQINL
DGDKYLHDDFAYATRDELIAKITFSDDQQRAREHGVSGRFAEIEFDFTLQSSAQPEEQHR
HERVRALED