Protein Info for AO353_22015 in Pseudomonas fluorescens FW300-N2E3

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details PF05940: NnrS" amino acids 14 to 390 (377 residues), 361.9 bits, see alignment E=2.4e-112

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 82% identity to pba:PSEBR_a3163)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLV4 at UniProt or InterPro

Protein Sequence (396 amino acids)

>AO353_22015 short-chain dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MQVLERRKALAIPPLLRLAFRPFFLAGCLLAVLVIPLWLAAFSGGISGWQPAGGWLGWHR
HELLFGFALAIIAGFLLTAVQTWTGRPGLSGKPLAALALLWLLARVAWLANAPWPLLAVL
ELAFPLAVAVLMGFTLWKVRQKRNYPIVLVLLLLAVADGLSLYGLVEGHEGWQRQGVLTG
IWLVAAMMGLIGGRVIPFFTQRGLGRVEGVAAWPWLDRLLLVGSPLVALLYAAGPALVPN
VWVGLLFAVLAAGHLVRLVRWHDRALWRVPLLWSLHLAYGWLAVACLGMAFWHFGVPVNP
SLAVHCLTIGAMGGLVLAMIARVSLGHTGRALEPPSGMTLAFIVLNLACLSRVVLILFFP
LTALWLAGLCWTLAFALFAWRYGPMLLRTRVDGHPG