Protein Info for AO353_21445 in Pseudomonas fluorescens FW300-N2E3

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 18 to 98 (81 residues), 72.6 bits, see alignment E=1.3e-24 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 18 to 103 (86 residues), 70.1 bits, see alignment E=7.8e-24

Best Hits

Swiss-Prot: 41% identical to PHAG_RHIME: Probable K(+)/H(+) antiporter subunit G (phaG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05564, multicomponent K+:H+ antiporter subunit G (inferred from 91% identity to pfo:Pfl01_3315)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WNJ5 at UniProt or InterPro

Protein Sequence (122 amino acids)

>AO353_21445 cation:proton antiporter (Pseudomonas fluorescens FW300-N2E3)
MNELGQLSLWVEIPVAILLVASSLFALIGAIGLLRLKDYFQRMHPPALASTLGAWCVALA
SIIFFSALQSSPVLHAWLIPILLSITMPVTTLLLARAALFRKRMAGDDVPAEVSSRRTES
ER