Protein Info for AO353_21135 in Pseudomonas fluorescens FW300-N2E3

Annotation: UDP-galactose-4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 153 (153 residues), 53.9 bits, E=6.2e-18
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 3 to 322 (320 residues), 433.5 bits, E=2.1e-134
• PF05368: NmrA
  • amino acids 4 to 117 (114 residues), 26.9 bits, E=1.3e-09
• PF02719: Polysacc_synt_2
  • amino acids 4 to 169 (166 residues), 33.5 bits, E=1.1e-11
• PF01370: Epimerase
  • amino acids 4 to 251 (248 residues), 192.1 bits, E=4.4e-60
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 312 (309 residues), 184.8 bits, E=1.2e-57
• PF01073: 3Beta_HSD
  • amino acids 4 to 154 (151 residues), 60.2 bits, E=6.7e-20
• PF13460: NAD_binding_10
  • amino acids 7 to 153 (147 residues), 37.8 bits, E=7.5e-13
• PF07993: NAD_binding_4
  • amino acids 64 to 172 (109 residues), 22.8 bits, E=1.9e-08

Best Hits

Swiss-Prot: 52% identical to GALE_BACHD: UDP-glucose 4-epimerase (galE) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 77% identity to pen:PSEEN2439)

MetaCyc: 54% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-β-L-arabinose biosynthesis I (from UDP-α-D-xylose) (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Sequence Analysis Tools

See A0A0N9VSA4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>AO353_21135 UDP-galactose-4-epimerase (Pseudomonas fluorescens FW300-N2E3)
MKFLVVGGAGYIGSHMVKQLLRAGHEPVVADNFSTGHRGALMGGRLVELDIADAQALDVL
FAGQHFDAVFHFASFTQVGESVTEPAKYYQNNLAGTLTLLQAVVRAGVKNFIFSSSAAIY
GDPVYVPIDEEHPKAAINPYGRSKWMVEQMLEDFDRAYGLKSVCLRYFNAAGADPEGQLG
ERREPETHLLPLILQAASGRRTTITVYGRDYDTPDGTCIRDYIHVVDLVAAHALAVNYLL
AGGASTALNLGNGQGFSVQQVIDTARAVTGQGISVSEAPRRVGDPPRLVADPRMANTLLG
WQPQYASLEQIVAHAWSWEQKYPWH