Protein Info for AO353_16930 in Pseudomonas fluorescens FW300-N2E3

Annotation: DNA base-flipping protein YbaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF01035: DNA_binding_1" amino acids 19 to 96 (78 residues), 71.5 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 32% identical to ATL1_SCHPO: Alkyltransferase-like protein 1 (atl1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K07443, methylated-DNA-protein-cysteine methyltransferase related protein (inferred from 86% identity to pfl:PFL_1258)

Predicted SEED Role

"methylated-DNA--protein-cysteine methyltransferase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VW37 at UniProt or InterPro

Protein Sequence (117 amino acids)

>AO353_16930 DNA base-flipping protein YbaZ (Pseudomonas fluorescens FW300-N2E3)
VTDANHETETPAQMRRTTLYLTLAQVPEGKVVSYGQLAELAGLGRAARWVGRTLSQLPGD
TKLPWHRVLAAGGRLSLPAGSPSGDEQRARLRMEGVSVLNNRVDIQRHGWRPVEHSG