Protein Info for AO353_13600 in Pseudomonas fluorescens FW300-N2E3
Annotation: precorrin-6Y C5,15-methyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to COBL_PSEAE: Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] (cobL) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00595, precorrin-6Y C5,15-methyltransferase / precorrin-8W decarboxylase [EC: 1.-.-.- 2.1.1.132] (inferred from 85% identity to pfo:Pfl01_0603)MetaCyc: 50% identical to precorrin-6B (C5,15) methyltransferase subunit (Pseudomonas denitrificans (nom. rej.))
Precorrin-6Y C(5,15)-methyltransferase (decarboxylating). [EC: 2.1.1.132]
Predicted SEED Role
"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)
MetaCyc Pathways
- adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
- cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
- cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Nucleotide sugars metabolism
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-
Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.132
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WIX6 at UniProt or InterPro
Protein Sequence (403 amino acids)
>AO353_13600 precorrin-6Y C5,15-methyltransferase (Pseudomonas fluorescens FW300-N2E3) MAPWLTVVGIGEDGFNGLGKNARRALLGASRIFGGQRQLDLLPVYVRGERQPWPSPFSLE PVLAQRGEPVCVLASGDPMLFGAGASLARQVPSDEMLILPAPSSCSLAAARMGWPLQEVV ALSVVARPIAALNAQLFSGVRLLVLSNDRHSPAAIAALLRERGFGPSRMTVLEHLGGASE RRVDGIASDWTDPVVADLNLIAIECLAAPDAPRLSRLAGLPDAAFKHDGQLTKRDVRAIT LARLAPVPGELLWDVGAGSGSIGIEWMRAHPSCRTLAIEADAGRQQLIEHNRDALGVPGL QLTRGSAPQALTGLERPDAIFIGGGVTRDGVLDTCWAQLKPGGRLVANAVTLQSEMTLMA WREQHGGELTRIHIAQAQPLGEFDTWRQALPITLLDVVKPFDA