Protein Info for AO353_12425 in Pseudomonas fluorescens FW300-N2E3

Annotation: ATP-dependent protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 3 to 446 (444 residues), 706.4 bits, see alignment E=7.9e-217 PF07728: AAA_5" amino acids 51 to 87 (37 residues), 24.9 bits, see alignment 5.5e-09 PF00004: AAA" amino acids 52 to 136 (85 residues), 33.2 bits, see alignment E=2e-11 amino acids 240 to 331 (92 residues), 28.3 bits, see alignment E=6.4e-10 PF07724: AAA_2" amino acids 172 to 328 (157 residues), 93.3 bits, see alignment E=5.3e-30

Best Hits

Swiss-Prot: 93% identical to HSLU_PSEF5: ATP-dependent protease ATPase subunit HslU (hslU) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 91% identity to pfo:Pfl01_0396)

MetaCyc: 72% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VP58 at UniProt or InterPro

Protein Sequence (446 amino acids)

>AO353_12425 ATP-dependent protease ATP-binding subunit HslU (Pseudomonas fluorescens FW300-N2E3)
MPMTPREIVHELSRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGV
GKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEMTKVRH
RAEDAAEERILDALLPPARMGFSNEDSAPAQDSNTRQLFRKRLREGQLDDKEIEIEVAEV
SGVDISAPPGMEEMTNQLQSLFANMGKGARKSRKLKVKEALRLVRDEEASRLVNDEELKA
KALEAVEQHGIVFIDEIDKVAKRGNTGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDH
ILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDFERILSEPHASLTEQYCALLKT
EGVTIEFQPDGIKRVAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSASDLASTHSEEP
IRIDADYVNSHLGELAQNEDLSRYIL